PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00027516-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 499aa    MW: 55548.4 Da    PI: 6.9976
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00027516-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.16.9e-092993361954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            F+   ++yp+ +++  LAk+ gLt +qV++WF N R +
  SMil_00027516-RA_Salv 299 FQHflHPYPKDSDKVMLAKQAGLTRSQVSNWFINARVR 336
                            675569******************************88 PP

2BELL104.85.7e-34181252172
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            e+qe+q+kkakL++ll++V++rYkqy eq+q+vi   e++ag+gsak YtslAl++iS++FrcLkdai+ qi
  SMil_00027516-RA_Salv 181 EKQEIQMKKAKLVDLLHQVEQRYKQYDEQMQMVIKWLEEAAGVGSAKTYTSLALQTISKQFRCLKDAIMLQI 252
                            689******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-39118250IPR006563POX domain
PfamPF075261.6E-39126249IPR006563POX domain
PROSITE profilePS5007112.098277340IPR001356Homeobox domain
CDDcd000867.76E-11280341No hitNo description
SMARTSM003894.1E-8280344IPR001356Homeobox domain
SuperFamilySSF466892.35E-16281348IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-28283346IPR009057Homeodomain-like
PfamPF059202.3E-17297336IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
LFCEMATYFH GNNTEMQGNG DALQTLILMN PAYNGYSDNL PPPPSSANFI FLNSSSSANA  60
ASQIQHLAGI PLQASPLQQD ARFLYSSAAR EVTRSKQGLS LSLSSQQPSQ PEEVRVFGAP  120
EKAALSCKYL KVAQQLLDEV VNIRKEANNG RESDNGQPKT TAEPPPGDGR AKCGADLTTA  180
EKQEIQMKKA KLVDLLHQVE QRYKQYDEQM QMVIKWLEEA AGVGSAKTYT SLALQTISKQ  240
FRCLKDAIML QIRGATTNLG EMNNHIPHPH PHHINNNNAW RPQRGLPERS VSVLRAWLFQ  300
HFLHPYPKDS DKVMLAKQAG LTRSQVSNWF INARVRLWKP MVEEMYAEEM KAQQRDGSEE  360
EDKTPKIEVQ NTSPAAQNNT RAKKPRNGDA SLSPSMNMSN AEIPMKLDYE SRQGFSITGA  420
PANFFASYDP VVGMEQFQQP YSSNGVSLTL GLQHCENLSN QMEAGTHHFG GFDASAMYDN  480
IDVQNNKRFA AQLLPDFVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15286344563Homeobox protein Meis2
3k2a_B1e-15286344563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094236.11e-156PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-105BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A068UQ861e-154A0A068UQ86_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000549451e-129(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-93BEL1-like homeodomain 1